PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast08G021900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family WRKY
Protein Properties Length: 408aa    MW: 42904.5 Da    PI: 7.086
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast08G021900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.51.4e-33190247259
                         --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                         +Dgy+WrKYGqK vk+s+fprsYYrCt ++Cpvkk+vers +d  vv++tYeg+H+h+
  Brast08G021900.1.p 190 EDGYRWRKYGQKAVKNSPFPRSYYRCTAQKCPVKKRVERSFQDAAVVITTYEGKHTHP 247
                         8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.809.1E-35174249IPR003657WRKY domain
SuperFamilySSF1182905.23E-29181249IPR003657WRKY domain
PROSITE profilePS5081131.789184249IPR003657WRKY domain
SMARTSM007747.0E-40189248IPR003657WRKY domain
PfamPF031061.9E-26190247IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MSGASQSHHL SGDFFQFAHD DQLASLFAPS AQQIQQPWPF LAADYLLLQH GAGAPPPLEL  60
DYGAAAFGFD APAPEPVKRE LLLQHEAADG AGGGTAHSVS MSSTSSGAGA GGGGDHEEAA  120
GKCKEEEGEG DESKEGSAAA AKGDGDQDKG SKGSDNNGKG KKKGGAGEKE KRPRQARFAF  180
MTKSEVDHLE DGYRWRKYGQ KAVKNSPFPR SYYRCTAQKC PVKKRVERSF QDAAVVITTY  240
EGKHTHPIPT TLRGNQQHLH LLAQHPHLHN NNNNPSFFRM PAPPAAAFFP PGSGAGFLQQ  300
HAATLQAMQQ QLAAAGSTTM ASSGMLLQAP APGGHGLHAM ATSSAAATTT TTTAVGSSGS  360
ISSATPALPL RMEHLMDYDG LLQDMLLPSS STFIQHDNET AGNINRR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A4e-26176249174WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3418443e-93AY341844.1 Oryza sativa (japonica cultivar-group) WRKY3 mRNA, complete cds.
GenBankAY3418553e-93AY341855.1 Oryza sativa (japonica cultivar-group) WRKY14 mRNA, complete cds.
GenBankAY8706043e-93AY870604.1 Oryza sativa (japonica cultivar-group) WRKY16 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010233118.11e-122PREDICTED: probable WRKY transcription factor 48 isoform X2
TrEMBLA0A0Q3QTM81e-122A0A0Q3QTM8_BRADI; Uncharacterized protein
STRINGBRADI2G16357.11e-113(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62337173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.11e-47WRKY DNA-binding protein 71